- IFI44 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82614
- Unconjugated
- MTAP44, TLDC5, p44
- This antibody was developed against Recombinant Protein corresponding to amino acids: PTNFQIDGRN RKVIMDLKTM ENLGLAQNCT ISIQDYEVFR CEDSLDERKI KGVIELRKSL LSALRTYEPY GSLVQQIRIL LLGP
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml (also 25ul)
- Rabbit
- Human
- IFI44
- Immunohistochemistry, Immunohistochemistry-Paraffin
- interferon induced protein 44
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
PTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGP
Specifications/Features
Available conjugates: Unconjugated